WFDC3 Polyclonal antibody

• 

  IHC staining of human pancreas using 24917-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24917-1-AP (WFDC3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human pancreas using 24917-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 24917-1-AP (WFDC3 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human testis using 24917-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24917-1-AP (WFDC3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human testis using 24917-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 24917-1-AP (WFDC3 Antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

WFDC3 Polyclonal Antibody for IHC, ELISA

Cat No. 24917-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

WAP14, WFDC3

---

Tested Applications

• Positive IHC detected in: human pancreas tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IHC: See 2 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

24917-1-AP targets WFDC3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20207

  Product name: Recombinant human WFDC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 25-231 aa of BC148860

  Sequence: GEHAKEGECPPHKNPCKELCQGDELCPAEQKCCTTGCGRICRDIPKGRKRDCPRVIRKQSCLKRCITDETCPGVKKCCTLGCNKSCVVPISKQKLAEFGGECPADPLPCEELCDGDASCPQGHKCCSTGCGRTCLGDIEGGRGGDCPKVLVGLCIVGCVMDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP

• Full Name: WAP four-disulfide core domain 3
• Calculated Molecular Weight: 231 aa, 25 kDa
• GenBank Accession Number: BC148860
• Gene Symbol: WFDC3
• Gene ID (NCBI): 140686
• RRID: AB_2879795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUB2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC,IF,CoIP	Cell Death Dis; WFDC3 inhibits tumor metastasis by promoting the ERβ-mediated transcriptional repression of TGFBR1 in colorectal cancer; Authors - Tianqi Liu ; KD Validated
human	IHC	FASEB J; WFDC3 sensitizes colorectal cancer to chemotherapy by regulating ATM/ATR kinase signaling pathway; Authors - Xinying Yang