WIZ Polyclonal antibody

• 

  IHC staining of mouse pancreas using 32378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 32378-1-AP (WIZ antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 32378-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 32378-1-AP (WIZ antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 32378-1-AP

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using WIZ antibody (32378-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

WIZ Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 32378-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

Protein Wiz, Widely-interspaced zinc finger-containing protein, Zinc finger protein 803, ZNF803

---

Tested Applications

• Positive IHC detected in: mouse pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32378-1-AP targets WIZ in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37337

  Product name: Recombinant human WIZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-745 aa of BC136641

  Sequence: YLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAHLRQFGVTEWCVNGSPIETLSEWIKHRPQKVGAYRSYIQGGRPFTKKFRSAGHGRDSDKRPSLGLAPGGLAVVGRSAGGEPGPEAGRAADGGERPLAASPPGTVKAEEHQRQNINKFERRQARPPDASAARGGEDTNDLQQKLEEV

• Full Name: widely interspaced zinc finger motifs
• GenBank Accession Number: BC136641
• Gene Symbol: WIZ
• Gene ID (NCBI): 58525
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95785
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.