WIZ Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WIZ Polyclonal antibody, PBS Only (32378-1-PBS)

• 

  IHC staining of mouse pancreas using 32378-1-AP (same clone as 32378-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 32378-1-AP (WIZ antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32378-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 32378-1-AP (same clone as 32378-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 32378-1-AP (WIZ antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 32378-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 32378-1-AP (same clone as 32378-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using WIZ antibody (32378-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 32378-1-PBS in a different storage buffer formulation.

WIZ Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 32378-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

Protein Wiz, Widely-interspaced zinc finger-containing protein, Zinc finger protein 803, ZNF803

---

Product Information

32378-1-PBS targets WIZ in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37337

  Product name: Recombinant human WIZ protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 530-745 aa of BC136641

  Sequence: YLGSVAAKRPLQEDRLLPAEVKAKTYIQTELPFKAKTLHEKTSHSSTEACCELCGLYFENRKALASHARAHLRQFGVTEWCVNGSPIETLSEWIKHRPQKVGAYRSYIQGGRPFTKKFRSAGHGRDSDKRPSLGLAPGGLAVVGRSAGGEPGPEAGRAADGGERPLAASPPGTVKAEEHQRQNINKFERRQARPPDASAARGGEDTNDLQQKLEEV

• Full Name: widely interspaced zinc finger motifs
• GenBank Accession Number: BC136641
• Gene Symbol: WIZ
• Gene ID (NCBI): 58525
• RRID: AB_3742588
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95785
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The WIZ protein, whose full name is "Widely-interspaced zinc finger-containing protein," belongs to the Krueppel-type C2H2 zinc finger protein family. Its core function is to act as a chromatin-associated transcription factor that operates within the nucleus, where it links the histone methyltransferases EHMT1 and EHMT2 with the CTBP transcriptional corepressor complex, thereby participating in the regulation of gene transcription activity.