WNK1 Monoclonal antibody, PBS Only

WNK1 Monoclonal Antibody for WB, FC (Intra), Indirect ELISA
Cat No. 68149-1-PBS
Clone No.1B6A10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, FC (Intra), Indirect ELISA

1B6A10, EC:2.7.11.1, HSAN2, HSN2, KDP

Formulation:  PBS Only
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

68149-1-PBS targets WNK1 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28044

Product name: Recombinant human WNK1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-209 aa of BC021121

Sequence: MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHTMDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPHREETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPPARSGSGGGSAKEPQEERSQQQDDIEELET

Predict reactive species
Full Name WNK lysine deficient protein kinase 1
Calculated Molecular Weight 251 kDa
Observed Molecular Weight250 kDa
GenBank Accession NumberBC021121
Gene Symbol WNK1
Gene ID (NCBI) 65125
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9H4A3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

WNK kinase is a unique serine-threonine kinase in which the lysine (K) residue in the catalytic domain, that is found in the majority of kinases is not conserved. In mammals, there are four WNK kinase family members (WNK1-4). WNK1 has 6 isoforms, such as long form WNK1 (L-WNK1, 250 kDa, strong expression in dorsal root ganglia and spinal cord) ; kidney-specific isoform (KS-WNK1, 207 kDa, lacks a kinase domain).KS-WNK1 cannot phosphorylate substrates and instead interacts with and modulates the actions of other WNKs via a carboxyl terminal HQ domain.

Loading...
||
New chat Able
正在加载,请稍候...