WNT5A/B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• WNT5A/B Recombinant monoclonal antibody (87705-1-RR)

• 

  WB analysis using 87705-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87705-1-RR (WNT5A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87705-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87705-1-RR against Human WNT5A/B were performed. The affinity constant is below 1 pM.

WNT5A/B Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87705-1-RR

Clone No.252960C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

WNT5A, hWNT5A, Protein Wnt 5a, Protein Wnt-5a, WNT5A B

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, SKOV-3 cells, HUVEC cells, SH-SY5Y cells, NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87705-1-RR targets WNT5A/B in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag31507

  Product name: Recombinant human WNT5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-380 aa of BC064694

  Sequence: EGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK

• Full Name: wingless-type MMTV integration site family, member 5A
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC064694
• Gene Symbol: WNT5A
• Gene ID (NCBI): 7474
• RRID: AB_3745707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P41221
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. There are 19 Wnt genes in the human genome that encode functionally distinct Wnt proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. Wnt members bind to the Frizzled family of seven-pass transmembrane proteins and activate several signaling pathway.