WSB1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• WSB1 Polyclonal antibody (11666-1-AP)

WSB1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11666-1-AP Copied!

Publications (11)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

WSB-1, WSB 1, WD repeat and SOCS box-containing protein 1, SWIP1, SOCS box-containing WD protein SWiP-1

• 

  WB analysis using 11666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11666-1-AP (WSB1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 11666-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 11666-1-AP (WSB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11666-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using WSB1 antibody (11666-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for WSB1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: COLO 320 cells, HepG2 cells, SMMC-7721 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11666-1-AP targets WSB1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2211

  Product name: Recombinant human WSB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC021110

  Sequence: MASFPPRVNEKEIVRLRTIGELLAPAAPFDKKCGRENWTVAFAPDGSYFAWSQGHRTVKLVPWSQCLQNFLLHGTKNVTNSSSLRLPRQNSDGGQKNKPREHIIDCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLVDHTEVVRDLTFAPDGSLILVSASRDKTLRVWDLKDDGNMMKVLRGHQNWVYSCAFSPDSSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRV

• Full Name: WD repeat and SOCS box-containing 1
• Calculated Molecular Weight: 421 aa, 47 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC021110
• Gene Symbol: WSB1
• Gene ID (NCBI): 26118
• RRID: AB_10949076
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6I7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WSB1 (or SWIP1) gene encodes WD repeat and SOCS box-containing protein 1, a member of the WD-protein subfamily. It contains several WD-repeats spanning most of the protein and an SOCS box in the C-terminus. Alternatively spliced transcript variants encoding 3 distinct isoforms have been found for this gene. WSB1 serves as a probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Ubiquitination and degradation of homeodomain-interacting protein kinase 2 by WSB1 has been reported (PMID: 15965468), initiated by the interaction of the two components (PMID: 18093972). WSB1 is also a part of an E3 ubiquitin ligase for the thyroid-hormone-activating type 2 iodothyronine deiodinase (D2) (PMID: 15965468).

Publications

What published studies show

The WSB1 antibody (Cat# 11666-1-AP) has 11 total citations published in journals including Cell Metabolism, Cell Research, Cancer Research, PNAS, Genes & Development, International Journal of Biological Macromolecules, Frontiers in Immunology, Biochemical Pharmacology, International Journal of Molecular Sciences, Toxicology, and American Journal of Cancer Research. Research fields span cancer biology (metastasis, tumor progression, prostate/colorectal/osteosarcoma/glioma), cell metabolism, hypoxia, senescence, and ubiquitination signaling.

Automatically generated from the 11 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Metab; Mitochondrial VHL rewires cell metabolism in hypoxia.; Authors - Guobang Li ; KD Validated
human	WB	Cell Res; WSB1 overcomes oncogene-induced senescence by targeting ATM for degradation.; Authors - Jung Jin Kim
human	WB	Cancer Res; Hypoxia-Induced WSB1 Promotes the Metastatic Potential of Osteosarcoma Cells.; Authors - Ji Cao
		Proc Natl Acad Sci U S A; S-nitrosylation of pVHL regulates β2 adrenergic receptor function; Authors - Zachary W Grimmett
human	WB,IHC	Int J Biol Macromol; circWSB1 promotes tumor progression in ccRCC via circWSB1/miR-182-5p/WSB1 axis; Authors - Guyu Tang
human	WB	Genes Dev; WSB1 promotes tumor metastasis by inducing pVHL degradation.; Authors - Jung Jin Kim