WSB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WSB2 Polyclonal antibody, PBS Only (12124-2-PBS)

• 

  WB analysis of PC-3 using 12124-2-AP (same clone as 12124-2-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 12124-2-AP (WSB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12124-2-AP (same clone as 12124-2-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12124-2-AP (WSB2 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 12124-2-AP (same clone as 12124-2-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 12124-2-AP (WSB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• 

  WB analysis of rat kidney using 12124-2-AP (same clone as 12124-2-PBS)

  rat kidney tissue were subjected to SDS PAGE followed by western blot with 12124-2-AP (WSB2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse kidney using 12124-2-AP (same clone as 12124-2-PBS)

  IP result of anti-WSB2 (IP:12124-2-AP, 3ug; Detection:12124-2-AP 1:800) with mouse kidney tissue lysate 6000ug. This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 12124-2-AP (same clone as 12124-2-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using WSB2 antibody (12124-2-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 12124-2-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WSB2 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 12124-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

12124-2-PBS targets WSB2 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2768

  Product name: Recombinant human WSB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-404 aa of BC015887

  Sequence: MEAGEEPLLLAELKPGRPHQFDWKSSCETWSVAFSPDGSWFAWSQGHCIVKLIPWPLEEQFIPKGFEAKSRSSKNETKGRGSPKEKTLDCGQIVWGLAFSPWPSPPSRKLWARHHPQVPDVSCLVLATGLNDGQIKIWEVQTGLLLLNLSGHQDVVRDLSFTPSGSLILVSASRDKTLRIWDLNKHGKQIQVLSGHLQWVYCCSISPDCSMLCSAAGEKSVFLWSMRSYTLIRKLEGHQSSVVSCDFSPDSALLVTASYDTNVIMWDPYTGERLRSLHHTQVDPAMDDSDVHISSLRSVCFSPEGLYLATVADDRLLRIWALELKTPIAFAPMTNGLCCTFFPHGGVIATGTRDGHVQFWTAPRVLSSLKHLCRKALRSFLTTYQVLALPIPKKMKEFLTYRTF

• Full Name: WD repeat and SOCS box-containing 2
• Calculated Molecular Weight: 404 aa, 45 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC015887
• Gene Symbol: WSB2
• Gene ID (NCBI): 55884
• RRID: AB_2216206
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYS7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WSB2, also named SBA2, encodes WD repeat and SOCS box-containing protein 2. WSB2 may be a substrate-recognition component of an E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. WSB2 is a novel protein supposed to be involved in male- and female-specific gonadal development, and also a regulator of IL-21 receptor expression and IL21-induced signal transduction. WSB2 might be a promising novel biomarker of cell differentiation in colorectal cancer and its biological functions need further studies.