WWOX Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• WWOX Polyclonal antibody, PBS Only (15299-1-PBS)

• 

  WB analysis using 15299-1-AP (same clone as 15299-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15299-1-AP (WWOX antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 15299-1-AP (same clone as 15299-1-PBS)

  WB result of WWOX antibody (15299-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WWOX transfected MCF-7 cells. This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15299-1-AP (same clone as 15299-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15299-1-AP (WWOX antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse skeletal muscle using 15299-1-AP (same clone as 15299-1-PBS)

  IP result of anti-WWOX (IP:15299-1-AP, 4ug; Detection:15299-1-AP 1:500) with mouse skeletal muscle tissue lysate 4000ug. This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15299-1-AP (same clone as 15299-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15299-1-AP (WWOX antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15299-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

WWOX Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 15299-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

15299-1-PBS targets WWOX in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7555

  Product name: Recombinant human WWOX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-234 aa of BC003184

  Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

• Full Name: WW domain containing oxidoreductase
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 46 kDa
• GenBank Accession Number: BC003184
• Gene Symbol: WWOX
• Gene ID (NCBI): 51741
• RRID: AB_2216389
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NZC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.