WWOX Monoclonal antibody

• 

  WB analysis using 67725-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67725-1-Ig (WWOX antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 67725-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 67725-1-Ig (WWOX antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

WWOX Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67725-1-Ig

Clone No.1B8F4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig, mouse

Applications

WB, IHC, ELISA

Synonyms

D16S432E, FOR, FRA16D, HHCMA56, PRO0128, SDR41C1, WOX1, WWOX

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, pig liver tissue, rat liver tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67725-1-Ig targets WWOX in WB, IHC, ELISA applications and shows reactivity with Human, rat, pig, mouse samples.

• Tested Reactivity: Human, rat, pig, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7969

  Product name: Recombinant human WWOX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-234 aa of BC003184

  Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

• Full Name: WW domain containing oxidoreductase
• Calculated Molecular Weight: 47 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC003184
• Gene Symbol: WWOX
• Gene ID (NCBI): 51741
• RRID: AB_2882911
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.