WWOX Monoclonal antibody, PBS Only (Detector)

WWOX Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 67725-1-PBS
Clone No.1B8F4

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

FRA16D, FOR1, FOR, EC:1.1.1.-, D16S432E

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67725-1-PBS targets WWOX as part of a matched antibody pair:

MP51258-1: 67725-2-PBS capture and 67725-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7969

Product name: Recombinant human WWOX protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-234 aa of BC003184

Sequence: MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDENGQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFETAKSFALHGAHVILACRNMARASEAVSRILEEWQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG

Predict reactive species
Full Name WW domain containing oxidoreductase
Calculated Molecular Weight 47 kDa
Observed Molecular Weight40 kDa
GenBank Accession NumberBC003184
Gene Symbol WWOX
Gene ID (NCBI) 51741
RRIDAB_2882911
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZC7
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

WWOX(WW domain-containing oxidoreductase) is also named as FOR, WOX1 and belongs to the short-chain dehydrogenases/reductases (SDR) family. The gene encodes a 46 kDa protein that contains two WW domains and a short-chain dehydrogenase/reductase domain and the protein is lost or reduced in the majority of many cancer types including breast, prostate, esophageal, lung, stomach, and pancreatic carcinomas and in a large fraction of other cancer types(PMID:17360458). WWOX behaves as a potential tumor-suppressor gene(PMID:15064722). It has 7 isoforms produced by alternative splicing.

Loading...
||
New chat Able
正在加载,请稍候...