WWP2 Polyclonal antibody

• 

  WB analysis of HepG2 using 12197-1-AP

  WB result of WWP2 antibody (12197-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-WWP2 transfected HepG2 cells.

• 

  WB analysis using 12197-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12197-1-AP (WWP2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of A549 using 12197-1-AP

  IP result of anti-WWP2 (IP:12197-1-AP, 4ug; Detection:12197-1-AP 1:1000) with A549 cells lysate 800 ug.

• 

  IHC staining of human pancreas cancer using 12197-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12197-1-AP (WWP2 antibody) at dilution of 1:100 (under 40x lens).

• Featured Product
• KD/KO Validated

WWP2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 12197-1-AP

Publications(27)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

AIP2, EC:2.3.2.26, WW domain containing protein 2, WW domain-containing protein 2, WWp2 like

---

Tested Applications

• Positive WB detected in: HepG2 cells, NIH/3T3 cells, HSC-T6 cells
• Positive IP detected in: A549 cells
• Positive IHC detected in: human pancreas cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 25 publications below
• IHC: See 2 publications below
• IF: See 9 publications below
• IP: See 3 publications below
• CoIP: See 1 publications below

Product Information

12197-1-AP targets WWP2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2835

  Product name: Recombinant human WWP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-355 aa of BC013645

  Sequence: MASASSSRAGVALPFEKSQLTLKVVSAKPKVHNRQPRINSYVEVAVDGLPSETKKTGKRIGSSELLWNEIIILNVTAQSHLDLKVWSCHTLRNELLGTASVNLSNVLKNNGGKMENMQLTLNLQTENKGSVVSGGELTIFLDGPTVDLGNVPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRT

• Full Name: WW domain containing E3 ubiquitin protein ligase 2
• Calculated Molecular Weight: 870 aa, 99 kDa
• Observed Molecular Weight: 110-115 kDa
• GenBank Accession Number: BC013645
• Gene Symbol: WWP2
• Gene ID (NCBI): 11060
• RRID: AB_10597536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00308
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

WWP2(WW domain-containing protein 2) is also named as AIP2 and belongs to the NEDD4-like protein family. It functions as an E3 ubiquitin ligase for PTEN that plays a vital role in tumour-cell survival and is also involved in regulating transcription, embryonic stem-cell fate, cellular transport and T-cell activation processes(PMID:21532586).WWP2, which specifically interacted with ES cell-specific transcription factor Oct-4 and promoted its ubiquitination both in vitro and in vivo, is a ubiquitously expressed protein and exists in both cytoplasmic and nuclear compartments in ES cells(PMID:15047715).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Cell Death Differ; Endothelial cells-derived SEMA3G suppresses glioblastoma stem cells by inducing c-Myc degradation; Authors - Peng-Xiang Min
human	WB,IP,IF	Adv Sci (Weinh); Ubiquitination of NS1 Confers Differential Adaptation of Zika Virus in Mammalian Hosts and Mosquito Vectors; Authors - Chenxiao Huang
	WB,IF	Cardiovasc Diabetol; Down-regulation of WWP2 aggravates Type 2 diabetes mellitus-induced vascular endothelial injury through modulating ubiquitination and degradation of DDX3X; Authors - Shilong You ; KD Validated
human	WB	Cell Death Differ; Selective targeting of ubiquitination and degradation of PARP1 by E3 ubiquitin ligase WWP2 regulates isoproterenol-induced cardiac remodeling.; Authors - Naijin Zhang ; KD Validated
mouse	WB	Redox Biol; Role of WW domain E3 ubiquitin protein ligase 2 in modulating ubiquitination and Degradation of Septin4 in oxidative stress endothelial injury.; Authors - Naijin Zhang
human	WB	Br J Pharmacol; Costunolide represses hepatic fibrosis through WWP2-mediated Notch3 degradation.; Authors - Mao-Xu Ge