XAGE2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XAGE2 Polyclonal antibody (33118-1-AP)

• 

  WB analysis using 33118-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33118-1-AP (XAGE2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 33118-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using XAGE2 antibody (33118-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

XAGE2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33118-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Cancer/testis antigen 12.2, CT12.2, G antigen family D member 3, GAGED3, X antigen family member 2

---

Tested Applications

• Positive WB detected in: Caco-2 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33118-1-AP targets XAGE2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35814

  Product name: Recombinant human XAGE2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 17-111 aa of NM_130777

  Sequence: LQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV

• Full Name: X antigen family, member 2
• Calculated Molecular Weight: 12kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: NM_130777
• Gene Symbol: XAGE2
• Gene ID (NCBI): 9502
• RRID: AB_3742862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96GT9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XAGE2 (member 2 of the X antigen family), also known as CT12.2, GAGED3, XAGE-2, and XAGE2B, is a cancer-testis (CT) antigen that belongs to the GAGE family. This protein is strongly expressed in normal testes and is abnormally expressed in various tumors, including Ewing's sarcoma, rhabdomyosarcoma, breast cancer, and germ cell tumors. The XAGE2 protein shares sequence similarity with other GAGE/PAGE proteins, and its expression pattern and sequence similarity make it a member of the CT antigen family.