Tested Applications
| Positive WB detected in | Caco-2 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
33118-1-AP targets XAGE2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35814 Product name: Recombinant human XAGE2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 17-111 aa of NM_130777 Sequence: LQPPELIGAMLEPTDEEPKEEKPPTKSRNPTPDQKREDDQGAAEIQVPDLEADLQELCQTKTGDGCEGGTDVKGKILPKAEHFKMPEAGEGKSQV Predict reactive species |
| Full Name | X antigen family, member 2 |
| Calculated Molecular Weight | 12kDa |
| Observed Molecular Weight | 20 kDa |
| GenBank Accession Number | NM_130777 |
| Gene Symbol | XAGE2 |
| Gene ID (NCBI) | 9502 |
| RRID | AB_3742862 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q96GT9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
XAGE2 (member 2 of the X antigen family), also known as CT12.2, GAGED3, XAGE-2, and XAGE2B, is a cancer-testis (CT) antigen that belongs to the GAGE family. This protein is strongly expressed in normal testes and is abnormally expressed in various tumors, including Ewing's sarcoma, rhabdomyosarcoma, breast cancer, and germ cell tumors. The XAGE2 protein shares sequence similarity with other GAGE/PAGE proteins, and its expression pattern and sequence similarity make it a member of the CT antigen family.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for XAGE2 antibody 33118-1-AP | Download protocol |
| WB protocol for XAGE2 antibody 33118-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



