Use Able AI chat for product recommendations

XKR4 Polyclonal antibody, PBS Only

XKR4 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32981-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

hXKR4, KIAA1889, XK-related protein 4, XK-related protein 4, processed form, XRG4

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

32981-1-PBS targets XKR4 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag38049

Product name: Recombinant human XKR4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 508-650 aa of NM_052898

Sequence: MYYAFFHPNGPRFGQSPSCACEDPAAAFTLPPDVATSTLRSISNNRSVVSDRDQKFAERDGCVPVFQVRPTAPSTPSSRPPRIEESVIKIDLFRNRYPAWERHVLDRSLRKAILAFECSPSPPRLQYKDDALIQERLEYETTL

Predict reactive species
Full Name XK, Kell blood group complex subunit-related family, member 4
Calculated Molecular Weight650aa, 72 kDa
Observed Molecular Weight71 kDa
GenBank Accession NumberNM_052898
Gene Symbol XKR4
Gene ID (NCBI) 114786
RRIDAB_3742811
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity Purification
UNIPROT IDQ5GH76
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

XKR4 (XK-related protein 4) is a protein-coding gene located on human chromosome 8q12.2 that belongs to the XK family of membrane transporters . The encoded protein is predicted to function as a membrane transporter involved in the translocation of phospholipids and other substrates, though its precise physiological role remains incompletely characterized . XKR4 is widely expressed, with highest levels detected in the brain, testis, and adipose tissues . Genetic variants in XKR4 have been robustly associated with body weight regulation, obesity risk, and fat distribution in genome-wide association studies, and it has also been implicated in satiety signaling and feeding behavior . Additionally, mutations in this gene have been linked to altered adipogenesis and energy homeostasis, making it a relevant target for metabolic research .

Loading...
||
New chat

Able

正在加载,请稍候...