XPC Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XPC Polyclonal antibody (33279-1-AP)

• 

  WB analysis using 33279-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33279-1-AP (XPC antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

XPC Polyclonal Antibody for WB, ELISA

Cat No. 33279-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DNA repair protein complementing XP-C cells, p125, Xeroderma pigmentosum group C-complementing protein, XPCC

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33279-1-AP targets XPC in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38513

  Product name: Recombinant human XPC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 685-867 aa of NM_004628.4

  Sequence: HSRDTWLKKARVVRLGEVPYKMVKGFSNRARKARLAEPQLREENDLGLFGYWQTEEYQPPVAVDGKVPRNEFGNVYLFLPSMMPIGCVQLNLPNLHRVARKLDIDCVQAITGFDFHGGYSHPVTDGYIVCEEFKDVLLTAWENEQAVIERKEKEKKEKRALGNWKLLAKGLLIRERLKRRYGP

• Full Name: xeroderma pigmentosum, complementation group C
• Calculated Molecular Weight: 106kDa，940aa
• Observed Molecular Weight: 106-120 kDa
• GenBank Accession Number: NM_004628.4
• Gene Symbol: XPC
• Gene ID (NCBI): 7508
• RRID: AB_3742924
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q01831
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XPC (DNA repair protein complementing XP-C cells) protein is a pivotal DNA damage recognition factor that plays an indispensable role in the global-genome nucleotide excision repair (GG-NER) pathway. As the primary initiator of GG-NER, it acts as a universal sensor for a wide array of helix-distorting DNA lesions, including those induced by ultraviolet (UV) radiation and chemical carcinogens. Upon binding to damaged DNA, the XPC complex orchestrates the recruitment of the entire repair machinery, serving as a critical guardian of genomic integrity. The calculated molecular weight of XPC is about 106 kDa, but due to post-translational modifications, about 120 kDa will be observed.