XPNPEP3 Polyclonal antibody

• 

  WB analysis using 15655-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15655-1-AP (XPNPEP3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 15655-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15655-1-AP (XPNPEP3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human testis using 15655-1-AP

  human testis tissue were subjected to SDS PAGE followed by western blot with 15655-1-AP (XPNPEP3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human spleen using 15655-1-AP

  human spleen tissue were subjected to SDS PAGE followed by western blot with 15655-1-AP (XPNPEP3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of PC-3 using 15655-1-AP

  IP result of anti-XPNPEP3 (IP:15655-1-AP, 4ug; Detection:15655-1-AP 1:400) with PC-3 cells lysate 2000ug.

• 

  IHC staining of mouse liver using 15655-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15655-1-AP (XPNPEP3 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 15655-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15655-1-AP (XPNPEP3 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human oesophagus using 15655-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 15655-1-AP (XPNPEP3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human oesophagus using 15655-1-AP

  Immunohistochemical analysis of paraffin-embedded human oesophagus tissue slide using 15655-1-AP (XPNPEP3 Antibody) at dilution of 1:50 (under 40x lens).

XPNPEP3 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 15655-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

X Pro aminopeptidase 3, EC:3.4.11.9, APP3m, APP3c, APP3

---

Tested Applications

• Positive WB detected in: A431 cells, human testis tissue, human spleen tissue, PC-3 cells, 4T1 cells, mouse liver
• Positive IP detected in: PC-3 cells
• Positive IHC detected in: mouse liver tissue, human oesophagus tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15655-1-AP targets XPNPEP3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8007

  Product name: Recombinant human XPNPEP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 158-507 aa of BC004989

  Sequence: PSRELWDGPRSGTDGAIALTGVDEAYTLEEFQHLLPKMKAETNMVWYDWMRPSHAQLHSDYMQPLTEAKAKSKNKVRGVQQLIQRLRLIKSPAEIERMQIAGKLTSQAFIETMFTSKAPVEEAFLYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAELYEAVLEIQRDCLALCFPGTSLENIYSMMLTLIGQKLKDLGIMKNIKENNAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITIEPGIYIPEDDKDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSQAS

• Full Name: X-prolyl aminopeptidase (aminopeptidase P) 3, putative
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC004989
• Gene Symbol: XPNPEP3
• Gene ID (NCBI): 63929
• RRID: AB_2288500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XPNPEP3 gene encodes X-prolyl aminopeptidase 3 which functions to remove the penultimate N-terminal Proline residue from nascent proteins and appears to play a role in ciliary function. CRC tissue microarray revealed increased XPNPEP3 expression in tumor compared to matched normal samples (PMID:29383790). Other study found that XPNPEP3 localizes to mitochondria in renal cells in vitro and to kidney tubules in a cell type-specific pattern, and mutations in the gene are associated with NPHP-like disorder (PMID:20179356).