XRCC6BP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• XRCC6BP1 Polyclonal antibody (16076-1-AP)

XRCC6BP1 Polyclonal Antibody for WB, ELISA

Cat No. 16076-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

ATP23, EC:3.4.24.-, Ku70 binding protein 3, Ku70-binding protein 3, KUB3

• 

  WB analysis using 16076-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 16076-1-AP (XRCC6BP1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 16076-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 16076-1-AP (XRCC6BP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for XRCC6BP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16076-1-AP targets XRCC6BP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9042

  Product name: Recombinant human XRCC6BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC012776

  Sequence: MAGAPDERRRGPAAGEQLQQQHVSCQVFPERLAQGNPQQGFFSSFFTSNQKCQLRLLKTLETNPYVKLLLDAMKHSGCAVNKDRHFSCEDCNGNVSGGFDASTSQIVLCQNNIHNQAHMNRVVTHELIHAFDHCRAHVDWFTNIRHLACSEVRAANLSGDCSLVNEIFRLHFGLKQHHQTCVRDRATLSILAVRNISKEVAKKAVDEVFESCFNDHEPFGRIPHNKTYARYAHRDFENRDRYYSNI

• Full Name: XRCC6 binding protein 1
• Calculated Molecular Weight: 246 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC012776
• Gene Symbol: XRCC6BP1
• Gene ID (NCBI): 91419
• RRID: AB_2878213
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6H3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The XRCC6BP1 Polyclonal antibody (Cat# 16076-1-AP) has 1 total citation. It appears in Cell Reports (2025), in a study on genes essential for oxidative phosphorylation and mitochondrial origin in familial Ménière's disease. The research field encompasses mitochondrial biology, oxidative phosphorylation, and inherited inner ear disorders.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; An updated inventory of genes essential for oxidative phosphorylation identifies a mitochondrial origin in familial Ménière's disease; Authors - Marcell Harhai