YES1 Polyclonal antibody

• 

  IP experiment of A431 using 13977-1-AP

  IP result of anti-YES1 (IP:13977-1-AP, 4ug; Detection:13977-1-AP 1:300) with A431 cells lysate 2280 ug.

• 

  IHC staining of human breast cancer using 13977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13977-1-AP (YES1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 13977-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 13977-1-AP (YES1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13977-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13977-1-AP (YES1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 13977-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13977-1-AP (YES1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

YES1 Polyclonal Antibody for IP, IHC, ELISA

Cat No. 13977-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, IHC, ELISA

Synonyms

c yes, HsT441, P61 YES, Proto oncogene c Yes, Yes, YES1

---

Tested Applications

• Positive IP detected in: A431 cells
• Positive IHC detected in: human breast cancer tissue, human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13977-1-AP targets YES1 in IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5016

  Product name: Recombinant human YES1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 275-526 aa of BC048960

  Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL

• Full Name: v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC048960
• Gene Symbol: YES1
• Gene ID (NCBI): 7525
• RRID: AB_2877998
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P07947
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily. It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.