YES1 Polyclonal antibody

YES1 Polyclonal Antibody for IP, IHC, ELISA
Cat No. 13977-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, IHC, ELISA

c yes, HsT441, P61 YES, Proto oncogene c Yes, Yes, YES1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inA431 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13977-1-AP targets YES1 in IP, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5016

Product name: Recombinant human YES1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 275-526 aa of BC048960

Sequence: ESLRLEVKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFL

Predict reactive species
Full Name v-yes-1 Yamaguchi sarcoma viral oncogene homolog 1
Calculated Molecular Weight 61 kDa
Observed Molecular Weight 62 kDa
GenBank Accession NumberBC048960
Gene Symbol YES1
Gene ID (NCBI) 7525
RRIDAB_2877998
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07947
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

YES1, also named as p61-Yes and YES, belongs to the protein kinase superfamily, Tyr protein kinase family and SRC subfamily. It promotes infectivity of Neisseria gonorrhoeae in epithelial cells by phosphorylating MCP/CD46. YES1 catalyzes the reaction: ATP + a [protein]-L-tyrosine = ADP + a [protein]-L-tyrosine phosphate.

Protocols

Product Specific Protocols
IHC protocol for YES1 antibody 13977-1-APDownload protocol
IP protocol for YES1 antibody 13977-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...