YIPF7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YIPF7 Polyclonal antibody, PBS Only (21347-1-PBS)

• 

  IHC staining of mouse brain using 21347-1-AP (same clone as 21347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 21347-1-AP (YIPF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21347-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 21347-1-AP (same clone as 21347-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 21347-1-AP (YIPF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21347-1-PBS in a different storage buffer formulation.

YIPF7 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 21347-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

YIP1B, YIP1 family member 7, Yip1 domain family, member 7, Protein YIPF7, Five-pass transmembrane protein localizing in the Golgi apparatus and the endoplasmic reticulum 9

---

Product Information

21347-1-PBS targets YIPF7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15695

  Product name: Recombinant human YIPF7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-110 aa of BC103996

  Sequence: MDLLKISHTKLHLLEDLSIKNKQRMSNLAQFDSDFYQSNFTIDNQEQSGNDSNAYGNLYGSRKQQAGEQPQPASFVPSEMLMSSGYAGQFFQPASNSDYYSQSPYIDSFD

• Full Name: Yip1 domain family, member 7
• Calculated Molecular Weight: 280 aa, 31 kDa
• GenBank Accession Number: BC103996
• Gene Symbol: YIPF7
• Gene ID (NCBI): 285525
• RRID: AB_10734323
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8F6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YIPF7, or Yip1 domain family, member 7, is a protein that is part of the YIPF protein family. It is involved in regulating membrane dynamics and may play a role in disease pathways.