YOD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• YOD1 Polyclonal antibody (25370-1-AP)

• Featured Product
• KD/KO Validated

YOD1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 25370-1-AP Copied!

Publications (19)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

DUBA 8, DUBA8, HIN 7, HIN7, HIV 1 induced protease 7, HsHIN7, OTUD2, PRO0907, Ubiquitin thioesterase OTU1, YOD1

• 

  WB analysis using 25370-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25370-1-AP (YOD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 25370-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25370-1-AP (YOD1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of K-562 using 25370-1-AP

  IP result of anti-YOD1 (IP:25370-1-AP, 4ug; Detection:25370-1-AP 1:6000) with K-562 cells lysate 2400 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 25370-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25370-1-AP (YOD1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human spleen using 25370-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25370-1-AP (YOD1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for YOD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: K-562 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:100-1:400

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25370-1-AP targets YOD1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21881

  Product name: Recombinant human YOD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 63-348 aa of BC137167

  Sequence: LSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

• Full Name: YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 348 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC137167
• Gene Symbol: YOD1
• Gene ID (NCBI): 55432
• RRID: AB_2880048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VVQ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The YOD1 Polyclonal antibody (Cat# 25370-1-AP) has 19 citations. These appear in journals including Acta Pharm Sin B, Cell Death & Disease, Cancer Letters, Cell Death Discovery, Sci China Life Sci, EMBO Molecular Medicine, Cancer Cell International, JCI Insight, Mol Cell Proteomics, EMBO Reports, Cell Signaling, and Biochem Biophys Res Commun. Research fields span oncology (leukemia, renal, pancreatic, breast, and head-and-neck cancers), neuroinflammation, colitis, sepsis, osteoporosis, and ubiquitination/protein-modification biology.

Automatically generated from the 19 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	WB	Acta Pharm Sin B; Blockade of deubiquitinase YOD1 degrades oncogenic PML/RARα and eradicates acute promyelocytic leukemia cells; Authors - Xuejing Shao ; KD Validated
human	WB,IHC,IF,IP	Cell Death Dis; Deubiquitinase YOD1 suppresses tumor progression by stabilizing E3 ligase TRIM33 in head and neck squamous cell carcinoma; Authors - Yue Wu
human	WB,IP,IF	Cell Death Dis; The deubiquitinase YOD1 suppresses tumor progression by stabilizing ZNF24 in clear cell renal carcinoma; Authors - Ji Liu ; KD Validated
human	WB	Cancer Lett; POH1 induces Smad3 deubiquitination and promotes lung cancer metastasis; Authors - Yang Yuan
human	IF,IP,WB	Cell Death Discov; miR-221/222 induce instability of p53 By downregulating deubiquitinase YOD1 in acute myeloid leukemia; Authors - Han Zhong Pei ; KD Validated
pig	WB	Sci China Life Sci; CRISPR screening identifies protein methylation and ubiquitination modifications that modulate aflatoxin B1 cytotoxicity; Authors - Huaqiang Yang