YOD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YOD1 Polyclonal antibody, PBS Only (25370-1-PBS)

• 

  WB analysis using 25370-1-AP (same clone as 25370-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25370-1-AP (YOD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25370-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 25370-1-AP (same clone as 25370-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25370-1-AP (YOD1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25370-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 25370-1-AP (same clone as 25370-1-PBS)

  IP result of anti-YOD1 (IP:25370-1-AP, 4ug; Detection:25370-1-AP 1:6000) with K-562 cells lysate 2400 ug. This data was developed using the same antibody clone with 25370-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 25370-1-AP (same clone as 25370-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25370-1-AP (YOD1 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25370-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human spleen using 25370-1-AP (same clone as 25370-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 25370-1-AP (YOD1 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25370-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

YOD1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 25370-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

25370-1-PBS targets YOD1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21881

  Product name: Recombinant human YOD1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 63-348 aa of BC137167

  Sequence: LSSRTRVRELQGQIAAITGIAPGGQRILVGYPPECLDLSNGDTILEDLPIQSGDMLIIEEDQTRPRSSPAFTKRGASSYVRETLPVLTRTVVPADNSCLFTSVYYVVEGGVLNPACAPEMRRLIAQIVASDPDFYSEAILGKTNQEYCDWIKRDDTWGGAIEISILSKFYQCEICVVDTQTVRIDRFGEDAGYTKRVLLIYDGIHYDPLQRNFPDPDTPPLTIFSSNDDIVLVQALELADEARRRRQFTDVNRFTLRCMVCQKGLTGQAEAREHAKETGHTNFGEV

• Full Name: YOD1 OTU deubiquinating enzyme 1 homolog (S. cerevisiae)
• Calculated Molecular Weight: 348 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC137167
• Gene Symbol: YOD1
• Gene ID (NCBI): 55432
• RRID: AB_2880048
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5VVQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.