YPEL3 Polyclonal antibody, PBS Only

Name: YPEL3 Polyclonal antibody, PBS Only,
Brand: Proteintech

YPEL3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15403-1-PBS

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

FKSG5, Protein yippee like 3, Protein yippee-like 3, yippee like 3 (Drosophila)

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllIHC

IHC staining of human endometrial cancer using 15403-1-AP (same clone as 15403-1-PBS)
Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 15403-1-AP (YPEL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15403-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human endometrial cancer using 15403-1-AP (same clone as 15403-1-PBS)
Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 15403-1-AP (YPEL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15403-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for YPEL3 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

15403-1-PBS targets YPEL3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag7626 Product name: Recombinant human YPEL3 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-119 aa of BC005009 Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD Predict reactive species
Full Name	yippee-like 3 (Drosophila)
Calculated Molecular Weight	14 kDa
Observed Molecular Weight	14 kDa
GenBank Accession Number	BC005009
Gene Symbol	YPEL3
Gene ID (NCBI)	83719
RRID	AB_11042587
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P61236
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

YPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4.