YPEL3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YPEL3 Polyclonal antibody, PBS Only (15403-1-PBS)

• 

  WB analysis of BxPC-3 using 15403-1-AP (same clone as 15403-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 15403-1-AP (YPEL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 15403-1-AP (same clone as 15403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 15403-1-AP (YPEL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15403-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human endometrial cancer using 15403-1-AP (same clone as 15403-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 15403-1-AP (YPEL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15403-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

YPEL3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15403-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15403-1-PBS targets YPEL3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7626

  Product name: Recombinant human YPEL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-119 aa of BC005009

  Sequence: MVRISKPKTFQAYLDDCHRRYSCAHCRAHLANHDDLISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVADIHCENCKTTLGWKYEQAFESSQKYKEGKYIIELNHMIKDNGWD

• Full Name: yippee-like 3 (Drosophila)
• Calculated Molecular Weight: 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC005009
• Gene Symbol: YPEL3
• Gene ID (NCBI): 83719
• RRID: AB_11042587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61236
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YPEL3 is part of a five-member family of closely related paralogues: YPEL1-5, which are named in reference to their Drosophila ortholgue. Studies showed shat YPEL3 is regulated by p53 and its encoding protein induces cellular senescence in human tumor and normal cells, indicating that YPEL3 is a p53-dependent, tumor suppressor gene. (PMID:20388804) 15403-1-AP was raised against full length of YPEL3 protein (1-119aa); it can recognize YPEL1-4.