Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells, HSC-T6 cells, NIH/3T3 cells, MDA-MB-231 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
29441-1-AP targets YTHDC1 in WB, IHC, IF, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag31459 Product name: Recombinant human YTHDC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC053863 Sequence: MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPLSSSVSNNKRIVSTKGKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKRDPERRAKSPTPDGSERIGLEVDRRASRSSQSSKEEVNSEEYG Predict reactive species |
| Full Name | YTH domain containing 1 |
| Calculated Molecular Weight | 85 kDa |
| Observed Molecular Weight | ~100 kDa |
| GenBank Accession Number | BC053863 |
| Gene Symbol | YTHDC1 |
| Gene ID (NCBI) | 91746 |
| RRID | AB_2918307 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96MU7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YTHDC1, containing 1 YTH domain, is one of the m6A-binding proteins that can recognize and bind to the m6A methylation site and plays a specific role in gene expression. YTHDC1 is constitutively enriched in the nucleus. It regulates mRNA splicing by bridging the interactions between the trans- and cis-regulatory elements to bind targeted mRNAs. YTHDC1 mediates the export of m6A modified mRNA from the nucleus to the cytoplasm by interacting with SRSF3, which is an essential factor driving the tumorigenic process in various types of cancers including breast cancer, colon cancer, ovarian cancer, osteosarcoma, and glioblastoma (32368386).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for YTHDC1 antibody 29441-1-AP | Download protocol |
| IP protocol for YTHDC1 antibody 29441-1-AP | Download protocol |
| WB protocol for YTHDC1 antibody 29441-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The YTHDC1 Polyclonal antibody (Cat# 29441-1-AP) has 24 citations across journals including Cell Stem Cell, Autophagy, Experimental Molecular Medicine, Journal of Experimental & Clinical Cancer Research, Advanced Science, Cell Reports, Science Advances, and Journal of Biological Chemistry. Research fields span m6A RNA methylation, cancer biology (bladder, liver, glioma, neuroblastoma, AML), autophagy, glucose/lipid metabolism, inflammation, meiosis, iPSC reprogramming, and bone biology.
| Species | Application | Title |
|---|---|---|
Cell Stem Cell Decoding m6A RNA methylome identifies PRMT6-regulated lipid transport promoting AML stem cell maintenance | ||
Autophagy Lopinavir enhances anoikis by remodeling autophagy in a circRNA-dependent manner | ||
Exp Mol Med The YTHDC1/GLUT3/RNF183 axis forms a positive feedback loop that modulates glucose metabolism and bladder cancer progression
| ||
Exp Mol Med Loss of YTHDC1 m6A reading function promotes invasiveness in urothelial carcinoma of the bladder
| ||
J Exp Clin Cancer Res YTHDC1 is downregulated by the YY1/HDAC2 complex and controls the sensitivity of ccRCC to sunitinib by targeting the ANXA1-MAPK pathway | ||
J Exp Clin Cancer Res KAP1 stabilizes MYCN mRNA and promotes neuroblastoma tumorigenicity by protecting the RNA m6A reader YTHDC1 protein degradation |
Reviews
What customers say
The single review for this product is a 5-star rating from a Western Blot application using HEK293T cells at a 1:2000 dilution. The reviewer reported a clear band at approximately 100 kDa, indicating strong and specific detection performance.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Zhongwen (Verified Customer) (09-25-2023) | Clear band around 100KD
 |
