• Featured Product
  • KD/KO Validated

YTHDF1 Monoclonal antibody, PBS Only

YTHDF1 Monoclonal Antibody for WB, IHC, IP, Indirect ELISA
Cat No. 66745-1-PBS
Clone No.3A2H12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

3A2H12, C20orf21, DACA-1, DF1, YTH domain-containing family protein 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66745-1-PBS targets YTHDF1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11633

Product name: Recombinant human YTHDF1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 210-559 aa of BC050284

Sequence: VALTGVLSGNGGTNVNMPVSKPTSWAAIASKPAKPQPKMKTKSGPVMGGGLPPPPIKHNMDIGTWDNKGPVPKAPVPQQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAAFGQSGGAGSDSNSPGNVQPNSAPSVESHPVLEKLKAAHSYNPKEFEWNLKSGRVFIIKSYSEDDIHRSIKYSIWCSTEHGNKRLDSAFRCMSSKGPVYLLFSVNGSGHFCGVAEMKSPVDYGTSAGVWSQDKWKGKFDVQWIFVKDVPNNQLRHIRLENNDNKPVTNSRDTQEVPLEKAKQVLKIISSYKHTTSIFDDFAHYEKRQEEEEVVRKERQSRNKQ

Predict reactive species
Full Name YTH domain family, member 1
Calculated Molecular Weight 559 aa, 61 kDa
Observed Molecular Weight 60 kDa
GenBank Accession NumberBC050284
Gene Symbol YTHDF1
Gene ID (NCBI) 54915
RRIDAB_2882093
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9BYJ9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

YTHDF1, also named as YTH domain-containing family protein 1 or C20orf21, is a 559 amino acid protein, which localizes in the cytoplasm. YTHDF1 specifically recognizes and binds N6-methyladenosine (m6A)-containing mRNAs, and promotes mRNA translation efficiency. M6A is a modification present at internal sites of mRNAs and some non-coding RNAs and plays a role in the efficiency of mRNA splicing, processing and stability. YTHDF1 acts as a regulator of mRNA translation efficiency: promotes ribosome loading to m6A-containing mRNAs and interacts with translation initiation factors eIF3 (EIF3A or EIF3B) to facilitate translation initiation. YTHDF1 exists two isoform and calculated molecular weight of isoforms are 61 kDa and 21 kDa.

Loading...
||
New chat Able
正在加载,请稍候...