Tested Applications
| Positive WB detected in | HEK-293 cells, Jurkat cells, HeLa cells, MOLT-4 cells, NIH/3T3 cells, C6 cells, Raji cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | U2OS cells, HeLa cells, sodium arsenite treated HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24744-1-AP targets YTHDF2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, chIP, RIP, ELISA, CLIP applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, chicken, bovine, hamster, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5922 Product name: Recombinant human YTHDF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 339-565 aa of BC002559 Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE Predict reactive species |
| Full Name | YTH domain family, member 2 |
| Calculated Molecular Weight | 62 kDa |
| Observed Molecular Weight | 62 kDa |
| GenBank Accession Number | BC002559 |
| Gene Symbol | YTHDF2 |
| Gene ID (NCBI) | 51441 |
| RRID | AB_2687435 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5A9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
YTHDF2 also named as CLL associated antigen KW 14 or HGRG8 is a 579 amino acid protein, which contains one YTH domain and exists as two alternatively spliced isoforms. YTHDF2 is expressed in in pancreas, testis and placenta. YTHDF2 may play a role in human longevity. Due to the high sequence similarity, 24744-1-AP is likely to cross-react with both YTHDF1 and YTHDF3.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| IHC protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| IP protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| WB protocol for YTHDF2 antibody 24744-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
24744-1-AP is an anti-METTL3 antibody with 462 total citations. Citations appear in high-impact journals including Nature, Science, Cell, Nature Medicine, Nature Communications, Molecular Cell, Cancer Research, Cell Stem Cell, Nature Immunology, Nucleic Acids Research, and over 50 others. Research fields span m6A RNA methylation, oncology (glioblastoma, leukemia, colorectal, breast, liver, and other cancers), neuroscience, immunology, metabolism, viral infections, stem cell biology, ferroptosis, autophagy, and phase separation.
| Species | Application | Title |
|---|---|---|
Nature Dynamic m(6)A mRNA methylation directs translational control of heat shock response. | ||
Nature Anti-tumour immunity controlled through mRNA m6A methylation and YTHDF1 in dendritic cells. | ||
Nat Med Stem cell architecture drives myelodysplastic syndrome progression and predicts response to venetoclax-based therapy. |
Reviews
What customers say
All four reviews rate the antibody 5 stars. Users report reliable performance across Western Blot, IHC, immunofluorescence, and ChIP at dilutions of 1:1000–1:3000. One reviewer highlighted clear cytoplasmic staining recognizing stress granules in ICC, plus specific staining in mouse spinal cord tissue. Another confirmed strong WB results in porcine cells. Overall, customers describe the antibody as excellent, with good visibility and consistent results in both cell lines and tissue samples.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (12-25-2025) | Antibodies are excellent, we bought 2 vials, we are using it, visibility is good.
|
Tatyana (Verified Customer) (12-22-2024) | Works well in WB, ICC and IHC. ICC with antibody diluted in 5% goat serum in PBST, with 2 h incubation at RT. Cytoplasmic staining, recognises stress granules. WB with antibody diluted in 4% milk in TBST, with ON incubation. Also gives what looks like specific staining in mouse spinal cord (DAB and fluorescence).
 |
Jinyun (Verified Customer) (08-26-2022) | I did the western blot, and the antibody worked quite well.
|
Robert (Verified Customer) (01-24-2019) | 1. scrambled siRNA2. YTHDF2 siRNA
 |
