YTHDF2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• YTHDF2 Polyclonal antibody, PBS Only (24744-1-PBS)

• 

  WB analysis of Jurkat using 24744-1-AP (same clone as 24744-1-PBS)

  WB result of YTHDF2 antibody (24744-1-AP, 1:4000) with si-control and si-YTHDF2 transfected Jurkat cells.. This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24744-1-AP (same clone as 24744-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24744-1-AP (YTHDF2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 24744-1-AP (same clone as 24744-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24744-1-AP (YTHDF2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 24744-1-AP (same clone as 24744-1-PBS)

  IP result of anti-YTHDF2 (IP:24744-1-AP, 4ug; Detection:24744-1-AP 1:6000) with HeLa cells lysate 1360 ug. This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24744-1-AP (same clone as 24744-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24744-1-AP (YTHDF2 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24744-1-AP (same clone as 24744-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24744-1-AP (YTHDF2 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 24744-1-AP (same clone as 24744-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using YTHDF2 antibody (24744-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 24744-1-AP (same clone as 24744-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 24744-1-AP (same clone as 24744-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24744-1-AP (same clone as 24744-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed sodium arsenite treated HeLa cells using YTHDF2 antibody (24744-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CL488-phalloidin (green). This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24744-1-AP (same clone as 24744-1-PBS)

  Immunofluorescent analysis of HeLa cells using 24744-1-AP (YTHDF2 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 24744-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

YTHDF2 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 24744-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

Synonyms

CLL associated antigen KW 14, CLL-associated antigen KW-14, DF2, HGRG8, NY REN 2

---

Product Information

24744-1-PBS targets YTHDF2 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5922

  Product name: Recombinant human YTHDF2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 339-565 aa of BC002559

  Sequence: LSVQQQAAQPTRWVAPRNRGSGFGHNGVDGNGVGQSQAGSGSTPSEPHPVLEKLRSINNYNPKDFDWNLKHGRVFIIKSYSEDDIHRSIKYNIWCSTEHGNKRLDAAYRSMNGKGPVYLLFSVNGSGHFCGVAEMKSAVDYNTCAGVWSQDKWKGRFDVRWIFVKDVPNSQLRHIRLENNENKPVTNSRDTQEVPLEKAKQVLKIIASYKHTTSIFDDFSHYEKRQE

• Full Name: YTH domain family, member 2
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC002559
• Gene Symbol: YTHDF2
• Gene ID (NCBI): 51441
• RRID: AB_2687435
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5A9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

YTHDF2 also named as CLL associated antigen KW 14 or HGRG8 is a 579 amino acid protein, which contains one YTH domain and exists as two alternatively spliced isoforms. YTHDF2 is expressed in in pancreas, testis and placenta. YTHDF2 may play a role in human longevity. Due to the high sequence similarity, 24744-1-AP is likely to cross-react with both YTHDF1 and YTHDF3.