CoraLite® Plus 488-conjugated YWHAB Polyclonal antibody

YWHAB Polyclonal Antibody for IF/ICC
Cat No. CL488-10936

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

14 3 3 protein beta/alpha, 14 3 3,, GW128, HS1, KCIP 1, Protein 1054, YWHAB

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10936 targets YWHAB in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1383

Product name: Recombinant human YWHAB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-63 aa of BC010352

Sequence: MNDLICFLDNTFKNNVLSQAWWCVHLVPTIWEAEAGGSLEPRSLKLQCPVVAPVNNCTPAWAT

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide
Calculated Molecular Weight 28 kDa
GenBank Accession NumberBC010352
Gene Symbol YWHAB
Gene ID (NCBI) 7529
RRIDAB_3083888
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP31946
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

YWHAB (also known as 14-3-3 beta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised agaist the N-terminal region of human YWHAB.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 YWHAB antibody CL488-10936Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...