YWHAH Recombinant monoclonal antibody, PBS Only

YWHAH Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85987-1-PBS
Clone No.250473C7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

14-3-3 eta, 14 3 3 protein eta, 14-3-3, 14-3-3 protein eta

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85987-1-PBS targets YWHAH in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7435

Product name: Recombinant human YWHAH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-246 aa of BC003047

Sequence: MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Predict reactive species
Full Name tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC003047
Gene Symbol YWHAH
Gene ID (NCBI) 7533
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ04917
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

YWHAH (also known as 14-3-3 eta) is a member of 14-3-3 proteins which were the first phosphoserine/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody was raised against the full-length YWHAH.

Loading...
||
New chat Able
正在加载,请稍候...