ZBP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZBP1 Polyclonal antibody, PBS Only (13285-1-PBS)

• 

  WB analysis using 13285-1-AP (same clone as 13285-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13285-1-AP (ZBP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 13285-1-AP (same clone as 13285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 13285-1-AP (ZBP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13285-1-AP (same clone as 13285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13285-1-AP (ZBP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13285-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 13285-1-AP (same clone as 13285-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 13285-1-AP (ZBP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13285-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 13285-1-AP (same clone as 13285-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZBP1 antibody (13285-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 13285-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZBP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13285-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

C20orf183, DAI, DLM 1, DLM1, Tumor stroma and activated macrophage protein DLM-1

---

Product Information

13285-1-PBS targets ZBP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4119

  Product name: Recombinant human ZBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-149 aa of BC028218

  Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC

• Full Name: Z-DNA binding protein 1
• Calculated Molecular Weight: 46 kDa
• Observed Molecular Weight: 42-68 kDa
• GenBank Accession Number: BC028218
• Gene Symbol: ZBP1
• Gene ID (NCBI): 81030
• RRID: AB_2122651
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H171
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZBP1(Z-DNA-binding protein 1), also named as DAI or DLM-1, is a nucleic acid sensor with some isoforms. It has been reported that ZBP1 can sense the viral nucleic acids of viruses and induce the death of infected cells to prevent virus transmission. ZBP1 can be activated and causes necrocytosis without viral infection, which is associated with nuclear Z-form nucleic acids. ZBP1 can be detected 42 kDa, 55 kDa, 68 kDa isoforms (PMID: 37012234, PMID: 9121465).