ZBTB10 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZBTB10 Polyclonal antibody, PBS Only (22944-1-PBS)

• 

  WB analysis of A375 using 22944-1-AP (same clone as 22944-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 22944-1-AP (ZBTB10 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 22944-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse liver using 22944-1-AP (same clone as 22944-1-PBS)

  IP result of anti-ZBTB10 (IP:22944-1-AP, 3ug; Detection:22944-1-AP 1:1000) with mouse liver tissue lysate 12500ug. This data was developed using the same antibody clone with 22944-1-PBS in a different storage buffer formulation.

• 

  IP experiment using 22944-1-AP (same clone as 22944-1-PBS)

  IP result of ZBTB10 antibody (22944-1-AP for IP and Detection) with mouse liver tissue lysate. This data was developed using the same antibody clone with 22944-1-PBS in a different storage buffer formulation.

ZBTB10 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 22944-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

22944-1-PBS targets ZBTB10 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19094

  Product name: Recombinant human ZBTB10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 299-519 aa of BC127098

  Sequence: PESVVVDYNNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNVKIENDGCNVDEGQIENYQMNDSSWVQDGSPEMAENESEGQTKVFIWNNMGSQGIQETGKTRRKNQTTKRFIYNIPPNNETNLEDCSVMQPPVAYPEENTLLIKEEPDLDGALLSGPDGDRNVNANLLAEAGTSQDGGDAGTSHDFKYGLMPGPSNDFKYGLIPGTSNDFKYGLIPGAS

• Full Name: zinc finger and BTB domain containing 10
• Calculated Molecular Weight: 871 aa, 95 kDa
• Observed Molecular Weight: 65 kDa, 130 kDa
• GenBank Accession Number: BC127098
• Gene Symbol: ZBTB10
• Gene ID (NCBI): 65986
• RRID: AB_2879188
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q96DT7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger and BTB domain-containing protein 10 (ZBTB10), also known as RINZF, RINZFC, May be involved in transcriptional regulation. Multiple isoforms of ZBTB10 exist due to alternative splicing events.