ZBTB8A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZBTB8A Polyclonal antibody, PBS Only (24544-1-PBS)

• 

  WB analysis of HEK-293 using 24544-1-AP (same clone as 24544-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 24544-1-AP (ZBTB8A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24544-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 24544-1-AP (same clone as 24544-1-PBS)

  IP result of anti-ZBTB8A (IP:24544-1-AP, 3ug; Detection:24544-1-AP 1:300) with HEK-293 cells lysate 920ug. This data was developed using the same antibody clone with 24544-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 24544-1-AP (same clone as 24544-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 24544-1-AP (ZBTB8A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24544-1-PBS in a different storage buffer formulation.

ZBTB8A Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 24544-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

24544-1-PBS targets ZBTB8A in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21588

  Product name: Recombinant human ZBTB8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 106-296 aa of BC015239

  Sequence: QMTDVISVCKTFIKSSLDISEKEKDRYFSLSDKDANSNGVERSSFYSGGWQEGSSSPRSHLSPEQGTGIISGKSWNKYNYHPASQKNTQQPLAKHEPRKESIKKTKHLRLSQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYCTHVVKRKAD

• Full Name: zinc finger and BTB domain containing 8A
• Calculated Molecular Weight: 441 aa, 50 kDa
• Observed Molecular Weight: 55-60 kDa
• GenBank Accession Number: BC015239
• Gene Symbol: ZBTB8A
• Gene ID (NCBI): 653121
• RRID: AB_2879599
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96BR9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZBTB8A, also named as Zinc finger and BTB domain-containing protein 8A, is a 441 amino acid protein, which may be involved in transcriptional regulation. ZBTB8A may be a potential carcinogenic factor in gastric carcinoma, and may also be involved in gastric adenocarcinoma cell differentiation, cancer invasion and metastasis. The calcualted molecular weight of ZBTB8A is 50 kDa, but modified ZBTB8A is about 55-60 kDa.