ZDHHC8 Recombinant monoclonal antibody

• 

  WB analysis of HeLa using 86572-2-RR

  HeLa cells were subjected to SDS PAGE followed by western blot with 86572-2-RR (ZDHHC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 86572-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86572-2-RR (ZDHHC8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 86572-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86572-2-RR against Human ZDHHC8 were performed. The affinity constant is 0.915 nM.

ZDHHC8 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86572-2-RR

Clone No.251438A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

DHHC 8, DHHC8, DHHC-8, EC:2.3.1.225, KIAA1292

---

Tested Applications

• Positive WB detected in: U2OS cells, HeLa cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86572-2-RR targets ZDHHC8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag26028

  Product name: Recombinant human ZDHHC8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 274-430 aa of BC053544

  Sequence: LLDRAAPLKVKLSDNGLKAGLGRSKSKGSLDRLDEKPLDLGPPLPPKIEAGTFSSDLQTPRPGSAESALSVQRTSPPTPAMYKFRPAFPTGPKVPFCGPGEQVPGPDSLTLGDDSIRSLDFVSEPSLDLPDYGPGGLHAAYPPSPPLSASDAFSGAL

• Full Name: zinc finger, DHHC-type containing 8
• Calculated Molecular Weight: 83 kDa
• Observed Molecular Weight: 70-85 kDa
• GenBank Accession Number: BC053544
• Gene Symbol: ZDHHC8
• Gene ID (NCBI): 29801
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9ULC8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.