ZEB1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66279-1-Ig (same clone as 66279-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66279-1-Ig (same clone as 66279-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66279-1-Ig (same clone as 66279-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66279-1-Ig (same clone as 66279-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66279-1-Ig (same clone as 66279-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SKOV-3 using 66279-1-Ig (same clone as 66279-1-PBS)

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 66279-1-Ig (ZEB1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66279-1-Ig (same clone as 66279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66279-1-Ig (ZEB1 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66279-1-Ig (same clone as 66279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66279-1-Ig (ZEB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 66279-1-Ig (same clone as 66279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 66279-1-Ig (ZEB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66279-1-Ig (same clone as 66279-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66279-1-Ig (ZEB1 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 66279-1-Ig (same clone as 66279-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using ZEB1 antibody (66279-1-Ig, Clone: 1H1F1 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66279-1-PBS in a different storage buffer formulation.

ZEB1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66279-1-PBS

Clone No.1H1F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

1H1F1, AREB6, NIL2A, NIL-2-A zinc finger protein, TCF8

---

Product Information

66279-1-PBS targets ZEB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17118

  Product name: Recombinant human ZEB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 391-740 aa of BC112392

  Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL

• Full Name: zinc finger E-box binding homeobox 1
• Calculated Molecular Weight: 1125 aa, 124 kDa
• Observed Molecular Weight: 190-210 kDa
• GenBank Accession Number: BC112392
• Gene Symbol: ZEB1
• Gene ID (NCBI): 6935
• RRID: AB_2881662
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P37275
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa.