CoraLite® Plus 488-conjugated ZEB1 Recombinant monoclonal antibody

• 

  IF Staining of HEK-293 using CL488-85729

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CoraLite® Plus 488 ZEB1 antibody (CL488-85729, Clone: 243139F8 ) at dilution of 1:200, CL594-phalloidin (red).

ZEB1 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85729

Clone No.243139F8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

AREB6, NIL2A, NIL-2-A zinc finger protein, TCF8, TCF-8

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85729 targets ZEB1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag16204

  Product name: Recombinant human ZEB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 391-740 aa of BC112392

  Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL

• Full Name: zinc finger E-box binding homeobox 1
• Calculated Molecular Weight: 1125 aa, 124 kDa
• Observed Molecular Weight: 190-210 kDa
• GenBank Accession Number: BC112392
• Gene Symbol: ZEB1
• Gene ID (NCBI): 6935
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P37275
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ZEB1(zinc-finger-enhancer binding protein 1), which is a member of the Zinc finger-Homeobox (ZFH) family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene. Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post-phosphorylation of protein is about 190-210 kDa.