CoraLite®594-conjugated ZEB1 Monoclonal antibody

• 

  IF Staining of HEK-293 using CL594-66279

  Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using CoraLite®594 ZEB1 antibody (CL594-66279, Clone: 1H1F1 ) at dilution of 1:200.

• 

  IF Staining of U2OS using CL594-66279

  Immunofluorescent analysis of (4% PFA) fixed U2OS cells using CoraLite®594 ZEB1 antibody (CL594-66279, Clone: 1H1F1 ) at dilution of 1:200.

ZEB1 Monoclonal Antibody for IF/ICC

Cat No. CL594-66279

Clone No.1H1F1

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC

Synonyms

1H1F1, AREB6, NIL2A, NIL-2-A zinc finger protein, TCF8

---

Tested Applications

• Positive IF/ICC detected in: HEK-293 cells, U2OS cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66279 targets ZEB1 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17118

  Product name: Recombinant human ZEB1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 391-740 aa of BC112392

  Sequence: MVQAVVLPTVGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASPIQQGGHSVISAISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVATNSCKSEKLPEDLTVKSEKDKSFEGGVNDSTCLLCDDCPGDINALPELKHYDLKQPTQPPPLPAAEAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGSTTNGSRSSTPSPSPLNLSSSRNTQGYLYTAEGAQEEPQVEPLDLSL

• Full Name: zinc finger E-box binding homeobox 1
• Calculated Molecular Weight: 1125 aa, 124 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC112392
• Gene Symbol: ZEB1
• Gene ID (NCBI): 6935
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P37275
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

ZEB1(zinc-finger-enhancer binding protein 1), which is a members of the Zincfinger-Homeobox (ZFH)-family of repressors, acts as a transcriptional repressor that inhibits interleukin-2 (IL-2) gene expression. Depending on the quantity of cDNA and on the cell type, ZEB1 can enhance or repress the promoter activity of the ATP1A1 gene . Represses E-cadherin promoter and induces an epithelial-mesenchymal transition (EMT) by recruiting SMARCA4/BRG1. Represses BCL6 transcription in the presence of the corepressor CTBP1. Positively regulates neuronal differentiation. The calculated molecular weight of ZEB1 is 124 kDa, but the post phosphorylation of protein is about 190-210 kDa.