Product Information
25048-1-PBS targets ZFAND5 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19311 Product name: Recombinant human ZFAND5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 75-141 aa of BC027707 Sequence: NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE Predict reactive species |
| Full Name | zinc finger, AN1-type domain 5 |
| Calculated Molecular Weight | 213 aa, 23 kDa |
| Observed Molecular Weight | 23-35 kDa |
| GenBank Accession Number | BC027707 |
| Gene Symbol | ZFAND5 |
| Gene ID (NCBI) | 7763 |
| RRID | AB_3742134 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O76080 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ZFAND5 is Involved in protein degradation via the ubiquitin-proteasome system and may act by anchoring ubiquitinated proteins to the proteasome. It plays a role in ubiquitin-mediated protein degradation during muscle atrophy and in the regulation of NF-kappa-B activation and apoptosis. It can inhibit NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. It also inhibits tumor necrosis factor (TNF), IL-1, and TLR4-induced NF-kappa-B activation in a dose-dependent manner.
