ZFC3H1 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• ZFC3H1 Recombinant monoclonal antibody (86822-1-RR)

• 

  WB analysis using 86822-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86822-1-RR (ZFC3H1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

ZFC3H1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86822-1-RR

Clone No.251814F2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CCDC131, CSRC2, KIAA0546, PSRC2

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, U2OS cells, DU 145 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86822-1-RR targets ZFC3H1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34224

  Product name: Recombinant human ZFC3H1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1800-1989 aa of BC156732

  Sequence: RNKVQEFKFFTDLVNRCLVTVPARYPIPFSSADYWSNYEFHNRVIFFYLSCVPKTQHSKTLERFCSVMPANSGLALRLLQHEWEESNVQILKLQAKMFTYNIPTCLATWKIAIAAEIVLKGQREVHRLYQRALQKLPLCASLWKDQLLFEASEGGKTDNLRKLVSKCQEIGVSLNELLNLNSNKTESKNH

• Full Name: zinc finger, C3H1-type containing
• Calculated Molecular Weight: 226 kDa
• Observed Molecular Weight: 260 kDa
• GenBank Accession Number: BC156732
• Gene Symbol: ZFC3H1
• Gene ID (NCBI): 196441
• RRID: AB_3745144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60293
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFC3H1, also known as CCDC131 and PSRC2, is a large protein (1989 amino acids), with a C3H1- type zinc finger motif in its center, and contains five tetratricopeptide (TRP) repeats and six halftetratricopeptide (HAT) repeats at the C-terminal region. It is involved in the processing of a variety of RNAs and plays a critical role in the degradation of nuclear RNAs (PMID: 34514952).