ZFHX3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZFHX3 Polyclonal antibody, PBS Only (20157-1-PBS)

• 

  IHC staining of human breast cancer using 20157-1-AP (same clone as 20157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 20157-1-AP (same clone as 20157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 20157-1-AP (same clone as 20157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 20157-1-AP (same clone as 20157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 20157-1-AP (ZFHX3 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 20157-1-AP (same clone as 20157-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZFHX3 antibody (20157-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 20157-1-AP (same clone as 20157-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using ZFHX3 antibody (20157-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 20157-1-PBS in a different storage buffer formulation.

ZFHX3 Polyclonal Antibody for IHC, IF/ICC, Indirect ELISA

Cat No. 20157-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, Indirect ELISA

Synonyms

C16orf47, ATBT, AT-binding transcription factor 1, ATBF1, AT motif-binding factor 1

---

Product Information

20157-1-PBS targets ZFHX3 in IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14080

  Product name: Recombinant human ZFHX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 921-1270 aa of BC029653

  Sequence: QLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDMLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHESGVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFTIRRCPSTDPEEAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPGSSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQPMLRCPLCQDMLNNKIHLQLH

• Full Name: zinc finger homeobox 3
• Calculated Molecular Weight: 3703 aa, 404 kDa
• GenBank Accession Number: BC029653
• Gene Symbol: ZFHX3
• Gene ID (NCBI): 463
• RRID: AB_3669324
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15911
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Zinc finger homeobox protein 3 (ZFHX3) encodes a transcription factor which contains four homeodomains and seventeen zinc fingers. The ZFHX3 transcription factor appears to regulate myogenic and neuronal differentiation. Although the function of ZFHX3 in cardiac tissue is unknown, it is expressed in mouse hearts. (PMID: 26267381)