• Featured Product
  • KD/KO Validated

ZFP36 Monoclonal antibody, PBS Only

ZFP36 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66938-1-PBS
Clone No.1A5E6

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, pig

Applications

WB, IHC, Indirect ELISA

TTP, Zfp 36, Tristetraprolin, mRNA decay activator protein ZFP36, Growth factor-inducible nuclear protein NUP475

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66938-1-PBS targets ZFP36 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

Tested Reactivity human, mouse, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag28473

Product name: Recombinant human ZFP36 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-326 aa of BC009693

Sequence: MDLTAIYESLLSLSPDVPVPSDHGGTESSPGWGSSGPWSLSPSDSSPSGVTSRLPGRSTSLVEGRSCGWVPPPPGFAPLAPRLGPELSPSPTSPTATSTTPSRYKTELCRTFSESGRCRYGAKCQFAHGLGELRQANRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPSEDLAAPGHPPVLRQSISFSGLPSGRRTSPPPPGLAGPSLSSSSFSPSSSPPPPGDLPLSPSAFSAAPGTPLARRDPTPVCCPSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFEAGVFAPPQPVAAPRRLPIFNRISVSE

Predict reactive species
Full Name zinc finger protein 36, C3H type, homolog (mouse)
Calculated Molecular Weight 326 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC009693
Gene Symbol ZFP36
Gene ID (NCBI) 7538
RRIDAB_2882262
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP26651
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The expression of many cytokines is regulated post-transcriptionally by factors that modulate mRNA transport, translation, and stability. Much of this regulation occurs by the binding and stabilizing, or destabilizing, of cytokine mRNAs by proteins that recognize adenosine and uridine-rich elements (AREs) in untranslated regions of target transcripts. Zfp36 is a mRNA-binding protein involved in post-transcriptional regulation of AU-rich element (ARE)-containing mRNAs. It was demonstrated to physically interact with the p65 subunit of nuclear factor-κB leading to decreased nuclear import and diminished transcriptional activation mediated by nuclear factor-κB. It acted by specifically binding ARE-containing mRNAs and promoting their degradation, and has a crucial role in the post-transcriptional regulation of tumor necrosis factor (TNF).

Loading...
||
New chat

Able

正在加载,请稍候...