SARA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SARA Polyclonal antibody (22033-1-AP)

• Featured Product
• KD/KO Validated

SARA Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22033-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

hSARA, Madh interacting protein, MADHIP, Novel serine protease, NSP, Receptor activation anchor, SARA, SMADIP, ZFYVE9

• 

  WB analysis using 22033-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 22033-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 22033-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 22033-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 22033-1-AP (SARA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 22033-1-AP

  IP result of anti-SARA (IP:22033-1-AP, 5ug; Detection:22033-1-AP 1:1000) with mouse brain tissue lysate 5000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 22033-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 22033-1-AP (SARA antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human kidney using 22033-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 22033-1-AP (SARA antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse brain using 22033-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using SARA antibody (22033-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse kidney using 22033-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse kidney tissue using SARA antibody (22033-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SARA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, MCF-7 cells, human brain tissue, HeLa cells
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse brain tissue, mouse kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

22033-1-AP targets SARA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16929

  Product name: Recombinant human ZFYVE9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1075-1425 aa of BC032680

  Sequence: MLRLGAEYRLYPCPLFSVRFRKPLFGETGHTIMNLLADFRNYQYTLPVVQGLVVDMEVRKTSIKIPSNRYNEMMKAMNKSNEHVLAGGACFNEKADSHLVCVQNDDGNYQTQAISIHNQPRKVTGASFFVFSGALKSSSGYLAKSSIVEDGVMVQITAENMDSLRQALREMKDFTITCGKADAEEPQEHIHIQWVDDDKNVSKGVVSPIDGKSMETITNVKIFHGSEYKANGKVIRWTEVFFLENDDQHNCLSDPADHSRLTEHVAKAFCLALCPHLKLLKEDGMTKLGLRVTLDSDQVGYQAGSNGQPLPSQYMNDLDSALVPVIHGGACQLSEGPVVMELIFYILENIV

• Full Name: zinc finger, FYVE domain containing 9
• Calculated Molecular Weight: 1425 aa, 156 kDa
• Observed Molecular Weight: 156 kDa
• GenBank Accession Number: BC032680
• Gene Symbol: SARA
• Gene ID (NCBI): 9372
• RRID: AB_11182938
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95405
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ZFYVE9, also known as SARA (Smad anchor for receptor activation), is a double zinc finger (FYVE domain) protein that interacts directly with SMAD2 and SMAD3, and is involved in Alzheimer's disease. SARA functions to recruit SMAD2/SMAD3 to intracellular membranes and to the TGF-beta receptor. SARA plays a significant role in TGF-mediated signaling by regulating the subcellular location of SMAD2 and SMAD3 and modulating the transcriptional activity of the SMAD3/SMAD4 complex. SARA is possibly associated with TGF-beta receptor internalization.

Publications

What published studies show

The anti-SARA antibody (Cat# 22033-1-AP) has 5 citations published in Autophagy, Science Advances, Journal of Bone and Mineral Research, Structure, and FASEB Journal. Research fields span autophagy and wound healing, KSHV viral infection in mesenchymal stem cells, TGF-β/Smad signaling in bone biology and osteogenesis imperfecta, structural basis of SARA–HD-PTP interaction, and Smad-mediated peritoneal fibrosis. Applications include WB, IF, and IHC in human and mouse models.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Autophagy; Autophagic degradation of SQSTM1 enables fibroblast activation to accelerate wound healing; Authors - Yujiao Xu
human	WB,IF	Sci Adv; Neuropilin 1 is an entry receptor for KSHV infection of mesenchymal stem cell through TGFBR1/2-mediated macropinocytosis; Authors - Zheng-Zhou Lu ; KO Validated
mouse	WB,IF	J Bone Miner Res; Dysfunction of Caveolae-mediated Endocytic TβRI Degradation Results in Hypersensitivity of TGF-β/Smad Signaling in Osteogenesis Imperfecta; Authors - Changgui Shi
human	WB	Structure; Structural Basis for Specific Interaction of TGFβ Signaling Regulators SARA/Endofin with HD-PTP.; Authors - Deepankar Gahloth ; KD Validated
mouse, human	WB,IHC	FASEB J; Parthenolide Alleviates Peritoneal Fibrosis by Blocking Smad2/3 Phosphorylation via Smad Anchor for Receptor Activation.; Authors - Ying Zhang