ZHX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZHX1 Polyclonal antibody, PBS Only (13903-1-PBS)

• 

  WB analysis using 13903-1-AP (same clone as 13903-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse kidney using 13903-1-AP (same clone as 13903-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13903-1-AP (same clone as 13903-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 13903-1-AP (same clone as 13903-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 13903-1-AP (same clone as 13903-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13903-1-AP (same clone as 13903-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13903-1-AP (same clone as 13903-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13903-1-AP (ZHX1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HEK-293 using 13903-1-AP (same clone as 13903-1-PBS)

  IP result of anti-ZHX1 (IP:13903-1-AP, 4ug; Detection:13903-1-AP 1:500) with HEK-293 cells lysate 3200ug. This data was developed using the same antibody clone with 13903-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZHX1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 13903-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

zinc fingers and homeoboxes 1

---

Product Information

13903-1-PBS targets ZHX1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4874

  Product name: Recombinant human ZHX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 524-873 aa of BC040481

  Sequence: SNQCLHLNNDSSTTIIIDSSDETTESPTVGTAQPKQSWNPFPDFTPQKFKEKTAEQLRVLQASFLNSSVLTDEELNRLRAQTKLTRREIDAWFTEKKKSKALKEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESGLARTDIVSWFGDTRYAWKNGNLKWYYYYQSANSSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILKDYYLKRKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGIELFEENEEEDEVIDDQEEDEEETDDSDTWEPPRHVKRKLSKSDD

• Full Name: zinc fingers and homeoboxes 1
• Calculated Molecular Weight: 873 aa, 98 kDa
• Observed Molecular Weight: 100-120 kDa
• GenBank Accession Number: BC040481
• Gene Symbol: ZHX1
• Gene ID (NCBI): 11244
• RRID: AB_2219214
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UKY1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Binding of the nuclear factor-Y complex (NF-Y) to the inverted CCAAT-box interferes with transcription activation through nucleosome reorganization. The three homologous proteins forming the zinc-fingers and homeoboxes (ZHX) family interact with the activation domain of NF-Ya to repress transcription [PMID:19348505,20509910]. Human zinc-fingers and homeoboxes 1 (ZHX1) was cloned as a protein that interacts with the activation domain (AD) of the A subunit of nuclear factor-Y (NF-YA) [PMID:12237128].