Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

ZIP8 Polyclonal antibody, PBS Only

ZIP8 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 20459-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

BIGM103, SLC39A8, ZIP 8, BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

20459-1-PBS targets ZIP8 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14292

Product name: Recombinant human SLC39A8 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 18-143 aa of BC012125

Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS

Predict reactive species
Full Name solute carrier family 39 (zinc transporter), member 8
Calculated Molecular Weight 460 aa, 50 kDa
Observed Molecular Weight 42-46 kDa, 75-90 kDa,150 kDa
GenBank Accession NumberBC012125
Gene Symbol ZIP8
Gene ID (NCBI) 64116
RRIDAB_10697830
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9C0K1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SLC39A8, also known as ZIP8, belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Recently it was found that ZIP8 expression is upregulated in human monocytes in response to LPS, TNF-α, and live bacteria, facilitating cytoprotection during the early inflammation. Besides zinc ZIP8 can also transport cadmium and manganese efficiently. It is predicted that ZIP8 contains 3 potential N-linked glycosylation sites and is subject to glycosylation, which may account for the presences of multiple molecular weights, such as 43 kDa, 49 kDa, 60 kDa, 75-90 kDa, 150 kDa, and 200 kDa.

Loading...
||
New chat

Able

正在加载,请稍候...