Home
Products
Primary Antibodies
ZIP8 Polyclonal antibody, PBS Only (20459-1-PBS)

Filter: AllWBIPIHC

WB analysis of mouse lung using 20459-1-AP (same clone as 20459-1-PBS)
mouse lung tissue were subjected to SDS PAGE followed by western blot with 20459-1-AP (ZIP8 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
WB analysis using 20459-1-AP (same clone as 20459-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 20459-1-AP (ZIP8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
WB analysis of mouse liver using 20459-1-AP (same clone as 20459-1-PBS)
mouse liver tissue were subjected to SDS PAGE followed by western blot with 20459-1-AP (ZIP8 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
WB analysis of mouse heart using 20459-1-AP (same clone as 20459-1-PBS)
mouse heart tissue were subjected to SDS PAGE followed by western blot with 20459-1-AP (ZIP8 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IP experiment of mouse liver using 20459-1-AP (same clone as 20459-1-PBS)
IP result of anti-ZIP8 (IP:20459-1-AP, 4ug; Detection:20459-1-AP 1:500) with mouse liver tissue lysate 6000ug. This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse small intestine using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:800 (under 4x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20459-1-AP (ZIP8 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 20459-1-AP (ZIP8 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20459-1-AP (ZIP8 antibody at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20459-1-AP (ZIP8 antibody at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20459-1-AP (ZIP8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 20459-1-AP (same clone as 20459-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta using 20459-1-AP (ZIP8 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20459-1-PBS in a different storage buffer formulation.

Featured Product
KD/KO Validated

ZIP8 Polyclonal antibody, PBS Only

Name: ZIP8 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 20459-1-PBS

ZIP8 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 20459-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

BIGM103, SLC39A8, ZIP 8, BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

20459-1-PBS targets ZIP8 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag14292 Product name: Recombinant human SLC39A8 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 18-143 aa of BC012125 Sequence: LGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASRVGVPEPGQLHFNQCLTAEEIFSLHGFSNATQITSSKFSVICPAVLQQLNFHPCEDRPKHKTRPSHSEVWGYGFLSVTIINLAS Predict reactive species
Full Name	solute carrier family 39 (zinc transporter), member 8
Calculated Molecular Weight	460 aa, 50 kDa
Observed Molecular Weight	42-46 kDa, 75-90 kDa,150 kDa
GenBank Accession Number	BC012125
Gene Symbol	ZIP8
Gene ID (NCBI)	64116
RRID	AB_10697830
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9C0K1
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

SLC39A8, also known as ZIP8, belongs to the ZIP family of metal ion transporters which function to transport zinc and/or other metal ion substrates from the extracellular space or organellar lumen into the cytoplasm. Recently it was found that ZIP8 expression is upregulated in human monocytes in response to LPS, TNF-α, and live bacteria, facilitating cytoprotection during the early inflammation. Besides zinc ZIP8 can also transport cadmium and manganese efficiently. It is predicted that ZIP8 contains 3 potential N-linked glycosylation sites and is subject to glycosylation, which may account for the presences of multiple molecular weights, such as 43 kDa, 49 kDa, 60 kDa, 75-90 kDa, 150 kDa, and 200 kDa.