Filter: AllWBIP

WB analysis using 24112-1-AP (same clone as 24112-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 24112-1-AP (ZMYM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24112-1-PBS in a different storage buffer formulation.
WB analysis using 24112-1-AP (same clone as 24112-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 24112-1-AP (ZMYM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24112-1-PBS in a different storage buffer formulation.
IP experiment of Raji using 24112-1-AP (same clone as 24112-1-PBS)
IP result of anti-ZMYM2 (IP:24112-1-AP, 4ug; Detection:24112-1-AP 1:600) with Raji cells lysate 1320 ug. This data was developed using the same antibody clone with 24112-1-PBS in a different storage buffer formulation.

ZMYM2 Polyclonal antibody, PBS Only

Name: ZMYM2 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 24112-1-PBS

ZMYM2 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 24112-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

FIM, MYM, RAMP, SCLL, Zinc finger protein 198

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

Freight/Packing: -

Quantity

- +

24112-1-PBS targets ZMYM2 in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21370 Product name: Recombinant human ZMYM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 166-252 aa of BC036372 Sequence: NAGMGNSGITTEPDSEIQIANVTTLETGVSSVNDGQLENTDGRDMNLMITHVTSLQNTNLGDVSNGLQSSNFGVNIQTYTPSLTSQT Predict reactive species
Full Name	zinc finger, MYM-type 2
Calculated Molecular Weight	1377 aa, 155 kDa
Observed Molecular Weight	155-180 kDa
GenBank Accession Number	BC036372
Gene Symbol	ZMYM2
Gene ID (NCBI)	7750
RRID	AB_3742104
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen Affinity purified
UNIPROT ID	Q9UBW7
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Able™