ZMYM3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZMYM3 Polyclonal antibody, PBS Only (25742-1-PBS)

• 

  WB analysis of mouse brain using 25742-1-AP (same clone as 25742-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25742-1-AP (ZMYM3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25742-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 25742-1-AP (same clone as 25742-1-PBS)

  IP result of anti-ZMYM3 (IP:25742-1-AP, 4ug; Detection:25742-1-AP 1:300) with K-562 cells lysate 3600ug. This data was developed using the same antibody clone with 25742-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 25742-1-AP (same clone as 25742-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 25742-1-AP (ZMYM3 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25742-1-PBS in a different storage buffer formulation.

ZMYM3 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 25742-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

DXS6673E, KIAA0385, MYM, XFIM, Zinc finger MYM type protein 3

---

Product Information

25742-1-PBS targets ZMYM3 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22701

  Product name: Recombinant human ZMYM3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-317 aa of BC013009

  Sequence: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATELLGLGGLLYKAPSPPEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRSERVRRAEPPKPEVVDSTESIPVSDEDSDAMVDDPNDEDFVPFRPRRSPRMSLRSSVSQRAGRSAVGTKMTCAHCRTP

• Full Name: zinc finger, MYM-type 3
• Calculated Molecular Weight: 1370 aa, 152 kDa
• Observed Molecular Weight: 190-200 kDa
• GenBank Accession Number: BC013009
• Gene Symbol: ZMYM3
• Gene ID (NCBI): 9203
• RRID: AB_2880221
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14202
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZMYM3, also named as DXS6673E, KIAA0385, and ZNF261, is a 1370 amino acid protein, which may be a component of a BHC histone deacetylase complex. ZMYM3 is most abundant in brain, moderate in muscle and heart, low in other tissues except placenta. ZMYM3 plays a role in the regulation of cell morphology and cytoskeletal organization.