ZNF101 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF101 Polyclonal antibody, PBS Only (25599-1-PBS)

• 

  WB analysis of HepG2 using 25599-1-AP (same clone as 25599-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25599-1-AP (ZNF101 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25599-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 25599-1-AP (same clone as 25599-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 25599-1-AP (ZNF101 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25599-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 25599-1-AP (same clone as 25599-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 25599-1-AP (ZNF101 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25599-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 25599-1-AP (same clone as 25599-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZNF101 antibody (25599-1-AP) at dilution of 1:600 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 25599-1-PBS in a different storage buffer formulation.

ZNF101 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 25599-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

HZF12

---

Product Information

25599-1-PBS targets ZNF101 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22390

  Product name: Recombinant human ZNF101 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-316 aa of BC119680

  Sequence: MRAHAGHKRSECGGEWRETPRKQKQHGKASISPSSGARRTVTPTRKRPYECKVCGKAFNSPNLFQIHQRTHTGKRSYKCREIVRAFTVSSFFRKHGKMHTGEKRYECKYCGKPIDYPSLFQIHVRTHTGEKPYKCKQCGKAFISAGYLRTHEIRSHALEKSHQCQECGKKLSCSSSLHRHERTHSGGKLYECQKCAKVFRCPTSLQAHERAHTGERPYECNKCGKTFNYPSCFRRHKKTHSGEKPYECTRCGKAFGWCSSLRRHEMTHTGEKPFDCKQCGKVFTFSNYLRLHERTHLAGRSQCFGRRQGDHLSPGV

• Full Name: zinc finger protein 101
• Calculated Molecular Weight: 436 aa, 50 kDa
• Observed Molecular Weight: 50-60 kDa
• GenBank Accession Number: BC119680
• Gene Symbol: ZNF101
• Gene ID (NCBI): 94039
• RRID: AB_2880152
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZC7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.