ZNF148 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of HeLa using 84338-6-RR (same clone as 84338-6-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using ZNF148 antibody (84338-6-RR, Clone: 241632A7 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 84338-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84338-6-RR

  Biolayer interferometry (BLl) kinetic assays of 84338-6-RR against Human ZNF148 were performed. The affinity constant is 2.71 nM.

ZNF148 Uni-rAb^® Recombinant Antibody for IF/ICC, Indirect ELISA

Cat No. 84338-6-PBS

Clone No.241632A7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, Indirect ELISA

Synonyms

Transcription factor ZBP 89, pHZ 52, HT BETA, BFCOL1, BERF 1

---

Product Information

84338-6-PBS targets ZNF148 in IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35742

  Product name: Recombinant human ZNF148 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 611-794 aa of BC035591

  Sequence: QALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

• Full Name: zinc finger protein 148
• GenBank Accession Number: BC035591
• Gene Symbol: ZNF148
• Gene ID (NCBI): 7707
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9UQR1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.