ZNF217 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• ZNF217 Monoclonal antibody (67730-1-Ig)

• Featured Product
• KD/KO Validated

ZNF217 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67730-1-Ig Copied!

Clone No. 1F11B6

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ZFP217, 1F11B6, ZABC1, Zinc finger protein 217

• 

  WB analysis using 67730-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67730-1-Ig

  WB result of ZNF217 antibody (67730-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF217 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 67730-1-Ig

  WB result of ZNF217 antibody (67730-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF217 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 67730-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 4T1 using 67730-1-Ig

  4T1 cells were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 67730-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 67730-1-Ig (ZNF217 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse skin using 67730-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 67730-1-Ig (ZNF217 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ZNF217 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: LNCaP cells, 4T1 cells, HEK-293 cells, MCF-7 cells, HepG2 cells, PC-3 cells, K-562 cells
• Positive IHC detected in: mouse skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67730-1-Ig targets ZNF217 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19468

  Product name: Recombinant human ZNF217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 707-1043 aa of BC113427

  Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP

• Full Name: zinc finger protein 217
• Calculated Molecular Weight: 1048 aa, 115 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC113427
• Gene Symbol: ZNF217
• Gene ID (NCBI): 7764
• RRID: AB_2882916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75362
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ZNF217 Monoclonal antibody (1F11B6), catalog number 67730-1-Ig, has 2 total citations. These appear in J Virol and J Cancer Res Clin Oncol. The cited research spans virology/epigenetics (identifying HNRNPA2B1 as an epigenetic repressor of Epstein-Barr virus reactivation) and oncology/lipid metabolism (ZNF217 driving hepatocellular carcinoma progression via FASN-mediated de novo lipid synthesis).

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		J Virol; Proteomic screening identifies HNRNPA2B1 as an epigenetic repressor of Epstein-Barr virus reactivation.; Authors - Febri Gunawan Sugiokto
		J Cancer Res Clin Oncol; The transcription factor ZNF217 drives hepatocellular carcinoma progression by activating de novo lipid synthesis via FASN upregulation.; Authors - Yihui Fang