• Featured Product
  • KD/KO Validated

ZNF217 Monoclonal antibody

ZNF217 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67730-1-Ig
Clone No.1F11B6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

ZFP217, 1F11B6, ZABC1, Zinc finger protein 217

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inLNCaP cells, 4T1 cells, HEK-293 cells, MCF-7 cells, HepG2 cells, PC-3 cells, K-562 cells
Positive IHC detected inmouse skin tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67730-1-Ig targets ZNF217 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19468

Product name: Recombinant human ZNF217 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 707-1043 aa of BC113427

Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP

Predict reactive species
Full Name zinc finger protein 217
Calculated Molecular Weight 1048 aa, 115 kDa
Observed Molecular Weight110-130 kDa
GenBank Accession NumberBC113427
Gene Symbol ZNF217
Gene ID (NCBI) 7764
RRIDAB_2882916
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75362
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for ZNF217 antibody 67730-1-IgDownload protocol
WB protocol for ZNF217 antibody 67730-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...