ZNF217 Monoclonal antibody, PBS Only

• 

  WB analysis using 67730-1-Ig (same clone as 67730-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67730-1-Ig (same clone as 67730-1-PBS)

  WB result of ZNF217 antibody (67730-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF217 transfected HEK-293 cells. This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67730-1-Ig (same clone as 67730-1-PBS)

  WB result of ZNF217 antibody (67730-1-Ig; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ZNF217 transfected HEK-293 cells. This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67730-1-Ig (same clone as 67730-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67730-1-Ig (same clone as 67730-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67730-1-Ig (ZNF217 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 67730-1-Ig (same clone as 67730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 67730-1-Ig (ZNF217 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skin using 67730-1-Ig (same clone as 67730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skin tissue slide using 67730-1-Ig (ZNF217 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67730-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ZNF217 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67730-1-PBS

Clone No.1F11B6

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

ZFP217, 1F11B6, ZABC1, Zinc finger protein 217

---

Product Information

67730-1-PBS targets ZNF217 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19468

  Product name: Recombinant human ZNF217 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 707-1043 aa of BC113427

  Sequence: IPSITCPFCTFKTFYPEVLMMHQRLEHKYNPDVHKNCRNKSLLRSRRTGCPPALLGKDVPPLSSFCKPKPKSAFPAQSKSLPSAKGKQSPPGPGKAPLTSGIDSSTLAPSNLKSHRPQQNVGVQGAATRQQQSEMFPKTSVSPAPDKTKRPETKLKPLPVAPSQPTLGSSNINGSIDYPAKNDSPWAPPGRDYFCNRSASNTAAEFGEPLPKRLKSSVVALDVDQPGANYRRGYDLPKYHMVRGITSLLPQDCVYPSQALPPKPRFLSSSEVDSPNVLTVQKPYGGSGPLYTCVPAGSPASSSTLEGKRPVSYQHLSNSMAQKRNYENFIGNAHYRP

• Full Name: zinc finger protein 217
• Calculated Molecular Weight: 1048 aa, 115 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC113427
• Gene Symbol: ZNF217
• Gene ID (NCBI): 7764
• RRID: AB_2882916
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75362
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.