ZNF232 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF232 Polyclonal antibody, PBS Only (21467-1-PBS)

• 

  WB analysis of PC-3 using 21467-1-AP (same clone as 21467-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 21467-1-AP (ZNF232 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21467-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 21467-1-AP (same clone as 21467-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 21467-1-AP (ZNF232 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21467-1-PBS in a different storage buffer formulation.

ZNF232 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21467-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

21467-1-PBS targets ZNF232 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15105

  Product name: Recombinant human ZNF232 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 95-445 aa of BC016039

  Sequence: EALSQLRVLCCEWLRPEKHTKEQILEFLVLEQFLTILPEELQSWVRGHHPKSGEEAVTVLEDLEKGLEPEPQVPGPAHGPAQEEPWEKKESLGAAQEALSIQLQPKETQPFPKSEQVYLHFLSVVTEDGPEPKDKGSLPQPPITEVESQVFSEKLATDTSTFEATSEGTLELQQRNPKAERLRWSPAQEESFRQMVVIHKEIPTGKKDHECSECGKTFIYNSHLVVHQRVHSGEKPYKCSDCGKTFKQSSNLGQHQRIHTGEKPFECNECGKAFRWGAHLVQHQRIHSGEKPYECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRVHARKEPSH

• Full Name: zinc finger protein 232
• Calculated Molecular Weight: 444 aa, 51 kDa
• Observed Molecular Weight: 48-51 kDa
• GenBank Accession Number: BC016039
• Gene Symbol: ZNF232
• Gene ID (NCBI): 7775
• RRID: AB_2878864
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNY5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.