ZNF253 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF253 Polyclonal antibody, PBS Only (25152-1-PBS)

• 

  WB analysis of HepG2 using 25152-1-AP (same clone as 25152-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 25152-1-AP (ZNF253 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25152-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SMMC-7721 using 25152-1-AP (same clone as 25152-1-PBS)

  SMMC-7721 cells were subjected to SDS PAGE followed by western blot with 25152-1-AP (ZNF253 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25152-1-PBS in a different storage buffer formulation.

ZNF253 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25152-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25152-1-PBS targets ZNF253 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18570

  Product name: Recombinant human ZNF253 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 63-130 aa of BC125063

  Sequence: LTMERHEMIAKPPVMSSHFAQDLWPENIQNSFQIGMLRRYEECRHDNLQLKKGCKSVGEHKVHKGGYN

• Full Name: zinc finger protein 253
• Calculated Molecular Weight: 499 aa, 58 kDa
• Observed Molecular Weight: 58-65 kDa
• GenBank Accession Number: BC125063
• Gene Symbol: ZNF253
• Gene ID (NCBI): 56242
• RRID: AB_2879927
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75346
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ZNF253, also named as Zinc finger protein 411 or BMZF1, is a 499 amino acid protein, which contains one KRAB domain and eleven C2H2-type zinc fingers. ZNF253 belongs to the krueppel C2H2-type zinc-finger protein family and is expressed in bone marrow and in monocytic and immature erythroid cell lines. ZNF253 may function as a transcription factor.