ZNF366 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• ZNF366 Polyclonal antibody, PBS Only (24340-1-PBS)

• 

  WB analysis of mouse heart using 24340-1-AP (same clone as 24340-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24340-1-AP (ZNF366 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 24340-1-AP (same clone as 24340-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 24340-1-AP (ZNF366 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24340-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 24340-1-AP (same clone as 24340-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 24340-1-AP (ZNF366 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24340-1-PBS in a different storage buffer formulation.

ZNF366 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24340-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24340-1-PBS targets ZNF366 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19591

  Product name: Recombinant human ZNF366 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 558-744 aa of BC121053

  Sequence: VMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAKVPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLSTKSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECLSLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI

• Full Name: zinc finger protein 366
• Calculated Molecular Weight: 744 aa, 85 kDa
• Observed Molecular Weight: 90-100 kDa
• GenBank Accession Number: BC121053
• Gene Symbol: ZNF366
• Gene ID (NCBI): 167465
• RRID: AB_2879500
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N895
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.